PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g088555.1
Common NameMTR_4g088555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 145aa    MW: 16950.6 Da    PI: 7.1386
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g088555.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP137.73.3e-4362138177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cqve+C+adlseak+yhrrhkvCe h+kap+v ++gl+qrfCqqCsrfh lsefD++krsCrrrLa+hnerrrk++
  Medtr4g088555.1  62 CCQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHIAGLQQRFCQQCSRFHGLSEFDDAKRSCRRRLAGHNERRRKSA 138
                      6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375756.3E-601144IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.105.4E-3657124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-4060141IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.98360137IPR004333Transcription factor, SBP-box
PfamPF031101.2E-3363136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
METRRSEGKR SLKYKEDHEE EEEEEEDTDF EEEEDGRRKR VVTDLYSKRS SKKAGSSNIP  60
PCCQVENCDA DLSEAKQYHR RHKVCEYHAK APAVHIAGLQ QRFCQQCSRF HGLSEFDDAK  120
RSCRRRLAGH NERRRKSAID YQGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3754136384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1424420.0BT142442.1 Medicago truncatula clone JCVI-FLMt-8F22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456994.11e-102squamosa promoter-binding-like protein
SwissprotQ387411e-47SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLI3SPP41e-102I3SPP4_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA07G31880.11e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53534153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-45squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]